Your Followed Topics

politics / leaders7 months ago

Russian president gives tour of his gilded Kremlin apartment

https://www.dailymail.co.uk/news/article-14669119/Inside-Putins-gilded-Kremlin-apartment-Dictator-gives-tour.htmlhttps://www.thesun.co.uk/news/34758766/putin-kremlin-apartment-tour/https://www.the-sun.com/news/14150454/putin-kremlin-apartment-tour/
Dailymail.co.uk and 3 more
Russian president gives tour of his gilded Kremlin apartment Open in Dailymail.co.uk
Highlights
  • Leaked images reveal Putin's luxury Kremlin residence, contrasting wealth with Ukraine war hardships.
  • Putin uses secluded Kremlin homes for diplomacy, while his wealth links to conflict amid Western sanctions.
  • Despite 250,000+ military deaths, Putin’s opulent lifestyle highlights his detachment from Russian suffering.
Vote 4
0

References

Putin gives tour of gilded Kremlin apartment with grand piano & chandeliers

https://www.thesun.co.uk/news/34758766/putin-kremlin-apartment-tour/Thesun.co.uk
Putin gives tour of gilded Kremlin apartment with grand piano & chandeliers

Putin gives tour of gilded Kremlin apartment with grand piano & chandeliers

https://www.the-sun.com/news/14150454/putin-kremlin-apartment-tour/The-sun.com
Putin gives tour of gilded Kremlin apartment with grand piano & chandeliers

Vladimir Putin gives rare glimpse inside his gilded Kremlin apartment

https://metro.co.uk/2025/05/02/vladimir-putin-gives-rare-glimpse-inside-gilded-kremlin-apartment-23012993/Metro.co.uk
Vladimir Putin gives rare glimpse inside his gilded Kremlin apartment

Related Topics

politicsleadersdiplomacywarwealthrussiavladimir putinputinimpactdisparitywealth disparityleadervladimirkremlinwar impactcontrast

0 Comments

Be the first to comment

Add your thoughts and get the conversation going.

Top 597 Internet News Today

#1
Selena Quintanilla's Dad Abraham Dead
#1 out of 59724.9M est. views0.00%
celebrities7h ago

Selena Quintanilla's Dad Abraham Dead

https://www.tmz.com/2025/12/13/selena-quintanilla-dad-abraham-dead/https://abc7.com/post/abraham-quintanilla-death-father-tejano-music-icon-selena-has-died-son-ab-iii-says/18283408/https://www.eonline.com/news/1426167/selena-quintanillas-dad-abraham-quintanilla-jr-dead-at-86
Tmz.com and 10 more
  • Abraham Quintanilla Jr., father of slain singer Selena Quintanilla Perez, has died at 86.
  • NBC News notes Quintanilla Jr. rose to prominence as a driving force behind his daughter’s global success.
  • In his later years, Quintanilla Jr. ran Q-Productions and led the Selena Foundation to aid underprivileged children.
Vote 48
0
#2
Social media star dies aged 9 after Ariana Grande sent message amid cancer fight
#2 out of 5971.1M est. views40.98%
health18h ago

Social media star dies aged 9 after Ariana Grande sent message amid cancer fight

https://www.mirror.co.uk/3am/celebrity-news/social-media-star-dies-aged-36395696https://people.com/social-media-star-brie-bird-dies-age-9-after-documenting-life-stage-4-cancer-11788984https://nypost.com/2025/12/13/entertainment/social-media-star-brie-bird-dies-at-age-9-following-stage-4-cancer-battle/
Mirror.co.uk and 4 more
  • The Mirror notes Brie Bird died at nine after a five-year fight with neuroblastoma, sharing her life online and inspiring thousands of fans.
  • Ariana Grande reached out with gifts and messages, highlighting how fan-celebrity bonds can comfort a child facing cancer and lift a family’s spirits.
  • Brie’s online community grew to about 650,000 followers, showing how families facing pediatric cancer rally around from online support networks.
Vote 36
0
#3
White House slams House Dems releasing Epstein photos showing Trump, Clinton, Woody Allen
#3 out of 59716.4M est. views0.00%
crime1d ago

White House slams House Dems releasing Epstein photos showing Trump, Clinton, Woody Allen

https://www.foxnews.com/politics/white-house-slams-house-dems-releasing-epstein-photos-showing-trump-clinton-woody-allenhttps://www.cbsnews.com/live-updates/epstein-files-trove-pictures-house-democrats/https://www.thedailybeast.com/rock-billionaire-jimmy-buffett-pictured-in-epstein-and-friends-photo-dump/
Foxnews.com and 38 more
  • New Epstein photo releases show Andrew with Bill Gates, renewing scrutiny of royals' ties to Epstein.
  • Democrats on the House Oversight Committee release Epstein photos, just hours after new images surfaced.
  • The disclosures broaden the narrative to personal and symbolic links between powerful figures and Epstein.
Vote 50
0
#4
Hailee Steinfeld Pregnant, Having First Baby With Josh Allen
#4 out of 5978.1M est. views0.00%
celebrities23h ago

Hailee Steinfeld Pregnant, Having First Baby With Josh Allen

https://www.tmz.com/2025/12/12/hailee-steinfeld-pregnant-josh-allen/https://people.com/hailee-steinfeld-josh-allen-expecting-first-baby-7502757https://www.today.com/parents/celebrity/hailee-steinfeld-pregnant-josh-allen-1st-child-rcna248945
Tmz.com and 26 more
  • BuzzFeed notes the pregnancy announcement arrived after a sequence of public relationship milestones, including the couple's May wedding.
  • Hailee Steinfeld revealed that she's pregnant with her first child, and she showed off her baby bump.
  • Selena Gomez and Benny Blanco are officially engaged after a year together, Gomez shared the update on Instagram on Dec. 11.
Vote 49
0
#5
Anger at Lionel Messi 'GOAT' India tour as fans throw chairs and bottles at stadium event
#5 out of 597721.3K est. views8.57%
sports12h ago

Anger at Lionel Messi 'GOAT' India tour as fans throw chairs and bottles at stadium event

https://www.bbc.co.uk/news/articles/c4g66nll48dohttps://www.independent.co.uk/sport/football/lionel-messi-india-tour-fan-chaos-inter-miami-b2883818.htmlhttps://www.theguardian.com/football/2025/dec/13/lionel-messi-india-tour-chaos-angry-fans-seats-pitch-kolkata
Bbc.co.uk and 16 more
  • Security struggled as fans threw bottles and the Salt Lake Stadium faced chaos during Messi's India appearance.
  • AP reports confirm chaotic start as fans storm the field and objects are hurled while security struggles to hold the line.
  • West Bengal's chief minister apologized for mismanagement and set up a committee to investigate and prevent repeats.
Vote 36
0
#6
Amy Schumer and Chris Fischer Divorcing After Over 7 Years of Marriage
#6 out of 5971.2M est. views10.36%
celebrities20h ago

Amy Schumer and Chris Fischer Divorcing After Over 7 Years of Marriage

https://www.tmz.com/2025/12/12/amy-schumer-chris-fischer-divorcing/https://www.huffpost.com/entry/scotus-blockbuster-case-2026-golden-globe-noms_n_6936a122e4b0a1c98be2a8f0/liveblog_693cc491e4b07bcd2545021ehttps://www.eonline.com/news/1425760/amy-schumer-husband-chris-fischer-break-up
Tmz.com and 19 more
  • Amy Schumer and Chris Fischer confirm they are ending their marriage, focusing on co-parenting their son Gene and preserving privacy.
  • Schumer reiterates that the split has nothing to do with weight loss or autism and remains a private, cohesive separation.
  • The couple, who began dating in 2017 and married in 2018, share a son born in May 2019, anchoring their united family amid the breakup.
Vote 42
0
#7
Preservation group sues Trump administration over White House ballroom project
#7 out of 59722.7M est. views0.00%
politics1d ago

Preservation group sues Trump administration over White House ballroom project

https://www.foxnews.com/politics/preservation-group-sues-trump-administration-white-house-ballroom-projecthttps://www.cbsnews.com/news/trump-white-house-ballroom-lawsuit-national-trust-for-historic-preservation/https://www.bbc.co.uk/news/articles/c07555m4710o
Foxnews.com and 14 more
  • The National Trust for Historic Preservation filed a federal lawsuit to halt construction until mandated reviews and public input are completed.
  • The suit argues no president may raze or alter federal property without due process, public comment, and congressional involvement.
  • The reference notes a broader legal framework that the White House says supports modernization, while the suit argues the project skipped mandated reviews.
Vote 49
0
#8
Legendary Utah coach Kyle Whittingham steps down
#8 out of 597584.3K est. views10.10%
sports1d ago

Legendary Utah coach Kyle Whittingham steps down

https://www.deseret.com/sports/2025/12/12/utah-utes-kyle-whittingham-retiring-leaves-lasting-legacy/https://www.cbssports.com/college-football/news/kyle-whittingham-steps-down-utah/https://www.sltrib.com/sports/utah-utes/2025/12/12/utah-football-coach-kyle/
Deseret.com and 11 more
  • Utah officially introduced Morgan Scalley as the next head coach, marking a formal transition after Kyle Whittingham steps down.
  • Whittingham retires after 21 seasons, paving Scalley's path to lead Utah with the defensive identity at the program’s core.
  • Scalley, a former All-American safety and longtime staffer, has shaped Utah’s identity since 2007 and is seen as uniquely equipped to lead.
Vote 40
0
#9
IDF kills senior Hamas official Ra'ad Sa'ad in Gaza City | The Jerusalem Post
#9 out of 597460.7K est. views520.66%
world6h ago

IDF kills senior Hamas official Ra'ad Sa'ad in Gaza City | The Jerusalem Post

https://www.jpost.com/israel-news/defense-news/article-880215https://nypost.com/2025/12/13/world-news/israel-kills-top-hamas-commander-raad-saad-with-idf-strike-in-gaza-city-official-says/https://www.bbc.com/news/articles/cx2dklj3rxvo
Jpost.com and 8 more
  • Israel says Saad was targeted in response to a Hamas attack that wounded two Israeli soldiers, framing the strike as retaliation in Gaza City.
  • Israel labels Saad as one of the architects of Hamas’ October 7 attack, highlighting his role in the group’s leadership and operations.
  • The strike is described as potentially the highest-profile Hamas assassination since a fragile ceasefire, signaling its political importance.
Vote 25
0
#10
Sources: Mets, IF Polanco agree on 2-year pact
#10 out of 597103.4K est. views66.42%
sports5h ago

Sources: Mets, IF Polanco agree on 2-year pact

https://www.espn.com/mlb/story/_/id/47294114/mets-jorge-polanco-agree-2-year-deal-sources-sayhttps://nypost.com/2025/12/13/sports/mets-sign-infielder-jorge-polanco-for-40-million-after-losing-pete-alonso/https://www.mlbtraderumors.com/2025/12/mets-to-sign-jorge-polanco.html
Espn.com and 4 more
  • Jorge Polanco and the New York Mets agreed to a two-year, $40 million contract, signaling a major roster upgrade for a reshaped lineup.
  • Polanco is expected to play first base and serve as DH, offering balance while remaining versatile across positions for the Mets.
  • The move marks the Mets’ first big step after Alonso and Díaz departures, signaling a rapid roster reset with added infield depth.
Vote 31
0

Explore Your Interests

Unlimited Access
Personalized Feed
Full Experience
or
By continuing, you agree to the Privacy Policy.. You also agree to receive our newsletters, you can opt-out any time.

Explore Your Interests

Create an account and enjoy content that interests you with your personalized feed

Unlimited Access
Personalized Feed
Full Experience
or
By continuing, you agree to the Privacy Policy.. You also agree to receive our newsletters, you can opt-out any time.

Advertisement

Advertisement