Your Followed Topics

crime / fraud7 months ago

Pittsburgh Funeral Home Tossed Pets’ Remains in Landfill, Prosecutors Say

https://nyti.ms/4lTKSSOhttps://abcnews.go.com/US/funeral-director-trashed-6500-bodies-pets-fake-ashes/storyhttps://people.com/pittsburgh-funeral-home-director-allegedly-threw-out-thousands-of-pets-bodies-11724117
Nyti.ms and 8 more
Pittsburgh Funeral Home Tossed Pets’ Remains in Landfill, Prosecutors Say Open in Nyti.ms
Highlights
  • Pennsylvania funeral director Patrick Vereb faces fraud charges after dumping remains and giving unrelated ashes.
  • Over 6,500 pet owners lost about $650,000 in Vereb's scam, with remains improperly disposed of at landfills.
  • Authorities urge tighter regulation in the pet cremation industry after Vereb’s betrayal of grieving families.
Vote 11
0

References

Funeral director trashed over 6,500 bodies of pets, used fake ashes to defraud customers out of $650,000: Officials

https://abcnews.go.com/US/funeral-director-trashed-6500-bodies-pets-fake-ashes/storyAbcnews.go.com
Funeral director trashed over 6,500 bodies of pets, used fake ashes to defraud customers out of $650,000: Officials

They Trusted Him to Give Their Pets Funerals. But Was He Throwing Animals' Remains in the Trash the Whole Time?

https://people.com/pittsburgh-funeral-home-director-allegedly-threw-out-thousands-of-pets-bodies-11724117People.com
They Trusted Him to Give Their Pets Funerals. But Was He Throwing Animals' Remains in the Trash the Whole Time?

Pittsburgh Funeral Home Tossed Pets’ Remains in Landfill, Prosecutors Say

https://www.nytimes.com/2025/04/29/us/funeral-director-dogs-cats-bodies.htmlNytimes.com
Pittsburgh Funeral Home Tossed Pets’ Remains in Landfill, Prosecutors Say

Pittsburgh mortuary owner accused of dumping pets' remains in landfill

https://www.nbcnews.com/news/us-news/pittsburgh-mortuary-owner-accused-dumping-pets-remains-landfill-rcna203535Nbcnews.com
Pittsburgh mortuary owner accused of dumping pets' remains in landfill

Heartless funeral director allegedly gave pet owners random animals’ ashes: ‘Devastation and heartache’

https://nypost.com/2025/04/29/us-news/heartless-pittsburgh-funeral-director-allegedly-gave-pet-owners-random-animals-ashes/Nypost.com
Heartless funeral director allegedly gave pet owners random animals’ ashes: ‘Devastation and heartache’

Funeral home ‘gave grieving owners the wrong animal’s ashes’

https://www.thetimes.com/us/news-today/article/pet-cremation-pittsburgh-pennsylvania-ashes-scam-pnnfff9rkThetimes.com
Funeral home ‘gave grieving owners the wrong animal’s ashes’

Pet undertaker sold grieving owners fake ashes after dumping bodies in landfill

https://www.dailystar.co.uk/news/us-news/pet-undertaker-conned-grieving-owners-35150672Dailystar.co.uk
Pet undertaker sold grieving owners fake ashes after dumping bodies in landfill

Funeral home allegedly gave grieving pet owners 'fake ashes' as horrific truth of where actual remains went revealed

https://www.unilad.com/news/us-news/pittsburgh-pet-funeral-service-owner-charged-deception-326598-20250501Unilad.com
Funeral home allegedly gave grieving pet owners 'fake ashes' as horrific truth of where actual remains went revealed

Related Topics

regulationcrimefraudscandalscampetpennsylvaniapatrick vereblandfill disposalpet cremation scam

0 Comments

Be the first to comment

Add your thoughts and get the conversation going.

Top 587 Internet News Today

#1
Selena Quintanilla's Dad Abraham Dead
#1 out of 58724.9M est. views8.84%
celebrities9h ago

Selena Quintanilla's Dad Abraham Dead

https://www.tmz.com/2025/12/13/selena-quintanilla-dad-abraham-dead/https://abc7.com/post/abraham-quintanilla-death-father-tejano-music-icon-selena-has-died-son-ab-iii-says/18283408/https://www.eonline.com/news/1426167/selena-quintanillas-dad-abraham-quintanilla-jr-dead-at-86
Tmz.com and 10 more
  • Abraham Quintanilla Jr., father of slain singer Selena Quintanilla Perez, has died at 86.
  • NBC News notes Quintanilla Jr. rose to prominence as a driving force behind his daughter’s global success.
  • In his later years, Quintanilla Jr. ran Q-Productions and led the Selena Foundation to aid underprivileged children.
Vote 48
0
#2
Sources: Mets, IF Polanco agree on 2-year pact
#2 out of 587111.8K est. views65.64%
sports7h ago

Sources: Mets, IF Polanco agree on 2-year pact

https://www.espn.com/mlb/story/_/id/47294114/mets-jorge-polanco-agree-2-year-deal-sources-sayhttps://nypost.com/2025/12/13/sports/mets-sign-infielder-jorge-polanco-for-40-million-after-losing-pete-alonso/https://www.mlbtraderumors.com/2025/12/mets-to-sign-jorge-polanco.html
Espn.com and 5 more
  • The Mets signed veteran infielder Jorge Polanco to a two-year deal, adding infield depth amid roster reshaping after Pete Alonso's departure.
  • Polanco delivered 26 homers and 78 RBIs this year, adding proven power to the Mets’ lineup during a period of turnover.
  • Polanco’s defense and durability are in focus, with surgery in October 2024 noted as a factor in evaluating his fit for the Mets.
Vote 33
0
#3
IDF kills senior Hamas official Ra'ad Sa'ad in Gaza City | The Jerusalem Post
#3 out of 587460.7K est. views14.94%
world8h ago

IDF kills senior Hamas official Ra'ad Sa'ad in Gaza City | The Jerusalem Post

https://www.jpost.com/israel-news/defense-news/article-880215https://nypost.com/2025/12/13/world-news/israel-kills-top-hamas-commander-raad-saad-with-idf-strike-in-gaza-city-official-says/https://www.foxnews.com/world/israel-announces-killed-one-architects-oct-7-attacks
Jpost.com and 8 more
  • Israel says Saad was targeted in response to a Hamas attack that wounded two Israeli soldiers, framing the strike as retaliation in Gaza City.
  • Israel labels Saad as one of the architects of Hamas’ October 7 attack, highlighting his role in the group’s leadership and operations.
  • The strike is described as potentially the highest-profile Hamas assassination since a fragile ceasefire, signaling its political importance.
Vote 25
0
#4
Anger at Lionel Messi 'GOAT' India tour as fans throw chairs and bottles at stadium event
#4 out of 587721.3K est. views8.45%
sports14h ago

Anger at Lionel Messi 'GOAT' India tour as fans throw chairs and bottles at stadium event

https://www.bbc.co.uk/news/articles/c4g66nll48dohttps://www.independent.co.uk/sport/football/lionel-messi-india-tour-fan-chaos-inter-miami-b2883818.htmlhttps://www.theguardian.com/football/2025/dec/13/lionel-messi-india-tour-chaos-angry-fans-seats-pitch-kolkata
Bbc.co.uk and 16 more
  • Security struggled as fans threw bottles and the Salt Lake Stadium faced chaos during Messi's India appearance.
  • AP reports confirm chaotic start as fans storm the field and objects are hurled while security struggles to hold the line.
  • West Bengal's chief minister apologized for mismanagement and set up a committee to investigate and prevent repeats.
Vote 36
0
#5
White House slams House Dems releasing Epstein photos showing Trump, Clinton, Woody Allen
#5 out of 58716.4M est. views0.00%
crime1d ago

White House slams House Dems releasing Epstein photos showing Trump, Clinton, Woody Allen

https://www.foxnews.com/politics/white-house-slams-house-dems-releasing-epstein-photos-showing-trump-clinton-woody-allenhttps://www.cbsnews.com/live-updates/epstein-files-trove-pictures-house-democrats/https://www.thedailybeast.com/rock-billionaire-jimmy-buffett-pictured-in-epstein-and-friends-photo-dump/
Foxnews.com and 38 more
  • Democrats released Epstein estate photos in stages to balance transparency with protecting trafficking victims' identities.
  • The new photo shows Steve Bannon chatting with Epstein at his New York townhouse, underscoring a wide network tied to Epstein.
  • The Epstein image dump broadens focus from legal scrutiny to personal and symbolic ties with powerful figures.
Vote 50
0
#6
Social media star dies aged 9 after Ariana Grande sent message amid cancer fight
#6 out of 5871.1M est. views5.88%
health20h ago

Social media star dies aged 9 after Ariana Grande sent message amid cancer fight

https://www.mirror.co.uk/3am/celebrity-news/social-media-star-dies-aged-36395696https://people.com/social-media-star-brie-bird-dies-age-9-after-documenting-life-stage-4-cancer-11788984https://nypost.com/2025/12/13/entertainment/social-media-star-brie-bird-dies-at-age-9-following-stage-4-cancer-battle/
Mirror.co.uk and 4 more
  • The Mirror notes Brie Bird died at nine after a five-year fight with neuroblastoma, sharing her life online and inspiring thousands of fans.
  • Ariana Grande reached out with gifts and messages, highlighting how fan-celebrity bonds can comfort a child facing cancer and lift a family’s spirits.
  • Brie’s online community grew to about 650,000 followers, showing how families facing pediatric cancer rally around from online support networks.
Vote 36
0
#7
Met Police won't launch investigation into claims Andrew Mountbatten-Windsor asked officer to dig dirt on accuser
#7 out of 58716.9K est. views73.93%
crime9h ago

Met Police won't launch investigation into claims Andrew Mountbatten-Windsor asked officer to dig dirt on accuser

https://news.sky.com/story/met-police-wont-launch-investigation-into-claims-andrew-mountbatten-windsor-asked-officer-to-dig-dirt-on-accuser-13482910https://www.theguardian.com/uk-news/2025/dec/13/met-will-not-investigate-claims-andrew-asked-bodyguard-to-investigate-virginia-giuffrehttps://www.bbc.com/news/articles/cvgr1djewxko
News.sky.com and 6 more
  • London police will not investigate claims that Andrew Mountbatten-Windsor asked a bodyguard in 2011 to dig up dirt on his accuser Virginia Giuffre, keeping the case closed for now.
  • The Met Police assessment found no additional evidence of criminal acts or misconduct related to the 2011 checks, underscoring a lack of new proof in the inquiry.
  • Giuffre’s death by suicide earlier this year is noted within ongoing scrutiny of Epstein-era allegations and Andrew’s denials.
Vote 17
0
#8
Hailee Steinfeld Pregnant, Having First Baby With Josh Allen
#8 out of 5878.1M est. views21.02%
celebrities1d ago

Hailee Steinfeld Pregnant, Having First Baby With Josh Allen

https://www.tmz.com/2025/12/12/hailee-steinfeld-pregnant-josh-allen/https://people.com/hailee-steinfeld-josh-allen-expecting-first-baby-7502757https://www.today.com/parents/celebrity/hailee-steinfeld-pregnant-josh-allen-1st-child-rcna248945
Tmz.com and 26 more
  • BuzzFeed notes the pregnancy announcement arrived after a sequence of public relationship milestones, including the couple's May wedding.
  • Hailee Steinfeld revealed that she's pregnant with her first child, and she showed off her baby bump.
  • Selena Gomez and Benny Blanco are officially engaged after a year together, Gomez shared the update on Instagram on Dec. 11.
Vote 49
0
#9
Amy Schumer and Chris Fischer Divorcing After Over 7 Years of Marriage
#9 out of 5871.3M est. views9.20%
celebrities22h ago

Amy Schumer and Chris Fischer Divorcing After Over 7 Years of Marriage

https://www.tmz.com/2025/12/12/amy-schumer-chris-fischer-divorcing/https://www.huffpost.com/entry/scotus-blockbuster-case-2026-golden-globe-noms_n_6936a122e4b0a1c98be2a8f0/liveblog_693cc491e4b07bcd2545021ehttps://www.eonline.com/news/1425760/amy-schumer-husband-chris-fischer-break-up
Tmz.com and 22 more
  • Comedian Amy Schumer and chef Chris Fischer have ended their marriage after seven years, asking for privacy while focusing on raising their son.
  • The couple’s split is framed as a private, amicable decision not driven by weight or autism concerns, preserving a respectful narrative.
  • Public messages of support from celebrities, including Jewel, show broad sympathy for Schumer during this private split.
Vote 47
0
#10
Legendary Utah coach Kyle Whittingham steps down
#10 out of 587593.8K est. views18.15%
sports1d ago

Legendary Utah coach Kyle Whittingham steps down

https://www.deseret.com/sports/2025/12/12/utah-utes-kyle-whittingham-retiring-leaves-lasting-legacy/https://www.cbssports.com/college-football/news/kyle-whittingham-steps-down-utah/https://www.sltrib.com/sports/utah-utes/2025/12/12/utah-football-coach-kyle/
Deseret.com and 12 more
  • Utah promotes Morgan Scalley from defensive coordinator to head coach, succeeding Whittingham after 21 seasons.
  • Whittingham steps down after 21 seasons as Utah coach, paving the way for Scalley to lead the program.
  • Scalley has spent a decade as Utah’s defensive coordinator, shaping the Utes’ defensive identity since 2007.
Vote 41
0

Explore Your Interests

Unlimited Access
Personalized Feed
Full Experience
or
By continuing, you agree to the Privacy Policy.. You also agree to receive our newsletters, you can opt-out any time.

Explore Your Interests

Create an account and enjoy content that interests you with your personalized feed

Unlimited Access
Personalized Feed
Full Experience
or
By continuing, you agree to the Privacy Policy.. You also agree to receive our newsletters, you can opt-out any time.

Advertisement

Advertisement